PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009631826.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 256aa    MW: 29555.1 Da    PI: 5.5938
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009631826.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++l+ ++++ G g+W++ ++  g+ R++k+c++rw +yl
   XP_009631826.1 14 KGPWSPEEDQILISYIQRNGHGNWRALPKQAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.22.9e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
   XP_009631826.1  67 RGNFTKEEEDTIIHLHEKLGNR-WSAIASRLQ-GRTDNEIKNIWHTHL 112
                      89********************.*********.***********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.99961IPR017930Myb domain
SuperFamilySSF466899.39E-3110108IPR009057Homeodomain-like
SMARTSM007172.4E-131363IPR001005SANT/Myb domain
PfamPF002492.4E-161461IPR001005SANT/Myb domain
CDDcd001671.51E-101661No hitNo description
PROSITE profilePS5129425.24962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2665117IPR009057Homeodomain-like
SMARTSM007171.3E-1466114IPR001005SANT/Myb domain
PfamPF002492.5E-1567112IPR001005SANT/Myb domain
CDDcd001678.56E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MVRAPCCDKM GLKKGPWSPE EDQILISYIQ RNGHGNWRAL PKQAGLLRCG KSCRLRWMNY  60
LSPDIKRGNF TKEEEDTIIH LHEKLGNRWS AIASRLQGRT DNEIKNIWHT HLKKRLKNYQ  120
PPRNSKRHYN TVNSDFSTSI QHEINSFGHP PNSPQISTSE VSTVTADSSS IITPATTDDQ  180
KAIKLEEIID SSEYFTEMHE SLWTNELAID DSSNFVTVAG EEFQSLDMFN TTMEDDMDFL  240
FNFFIRTEDL QELPEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631826.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLM1B1F61e-122M1B1F6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000348781e-122(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.14e-89myb domain protein 15